PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03606.1.p
Common NameEUGRSUZ_B03606, LOC104433774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 321aa    MW: 34981.9 Da    PI: 7.2059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03606.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-162370148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEdell+ ++++ G g+W+t +++ g+ R++k+c++rw +yl
  Eucgr.B03606.1.p 23 RGPWTPEEDELLAGYINREGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 70
                      89******************************99************97 PP

2Myb_DNA-binding476e-1581121648
                       HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.B03606.1.p  81 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 121
                       89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-211472IPR009057Homeodomain-like
PROSITE profilePS5129414.5621870IPR017930Myb domain
SuperFamilySSF466892.58E-2820117IPR009057Homeodomain-like
SMARTSM007171.6E-112272IPR001005SANT/Myb domain
PfamPF002498.6E-152370IPR001005SANT/Myb domain
CDDcd001671.70E-92570No hitNo description
PROSITE profilePS5129424.39771125IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2473126IPR009057Homeodomain-like
SMARTSM007172.7E-1375123IPR001005SANT/Myb domain
CDDcd001672.14E-1181121No hitNo description
PfamPF002499.9E-1481121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MRNPSSSSGG TKTPCCSKVG LKRGPWTPEE DELLAGYINR EGEGRWRTLP KRAGLLRCGK  60
SCRLRWMNYL RPSVKRGQIA PDEEDLILRL HRLLGNRWSL IAGRIPGRTD NEIKNYWNTH  120
LSKKLISQGI DPRTHKPLNP ETQNSSSNPP AKPPPSKAAP RPRSPNPSPI SSGLEETSSG  180
SPAILKENDQ IQSADNTEAV YQNGTATAHG GEASYLPGTQ HYHVMGLRSS HGLSNEEEED  240
LNCCGDDVFS SFLNSLINEE AFPIQHQLQQ QAVGSSPDSD SLIPMAAAPA FGIAAGWDSA  300
IMSSVINQDN NSRRANEQVE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24211255108B-MYB
1h8a_C5e-242112525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03606.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044942.10.0PREDICTED: transcription repressor MYB5
SwissprotQ388501e-84MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A059D9A80.0A0A059D9A8_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s21120.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.17e-84myb domain protein 5